missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198329

Invitrogen™ Human PSME3 (aa 9-135) Control Fragment Recombinant Protein

Product Code. 30198329
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198329

Brand: Invitrogen™ RP89273

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SFRS10 contains 1 RRM (RNA recognition motif) domain and belongs to the splicing factor SR family. It is a sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P61289
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10197
Name Human PSME3 (aa 9-135) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 11 S regulator complex gamma subunit; 11 S regulator complex subunit gamma; AA410043; Ab2-371; Activator of multicatalytic protease subunit 3; AU020960; epididymis secretory protein Li 283; HEL-S-283; Ki; Ki antigen; Ki nuclear autoantigen; PA28 gamma variant 5; pa28g; PA28gamma; PA28-gamma; prosome macropain; proteaseome (prosome, macropain) 28 subunit, 3; proteaseome (prosome, macropain) activator subunit 3 (PA28 gamma, Ki); proteasome (prosome, macropain) activator subunit 3; proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki); proteasome activator 28 subunit gamma; proteasome activator 28-gamma; proteasome activator complex subunit 3; proteasome activator subunit 3; Psme3; REG gamma-3; REGgamma; REG-gamma
Common Name PSME3
Gene Symbol PSME3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.