Invitrogen™ Human PSMD8 (aa 203-345) Control Fragment Recombinant Protein

Product Code. 30209432

Brand: Invitrogen™ RP89240

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52329 (PA5-52329. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 1.

Specifications

• Accession Number: P48556
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5714
• Name: Human PSMD8 (aa 203-345) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 26 S proteasome non-ATPase regulatory subunit 8; 26 S proteasome regulatory subunit p31; 26 S proteasome regulatory subunit RPN12; 26 S proteasome regulatory subunit S14; 6720456J22Rik; AA407360; AL033291; AL033322; AL033323; C76433; epididymis secretory sperm binding protein Li 91 n; HEL-S-91 n; HIP6; HYPF; Nin1p; p31; proteasome (prosome, macropain) 26 S subunit, non-ATPase, 8; proteasome 26 S non-ATPase subunit 8; proteasome 26 S subunit, non-ATPase 8; proteasome 26 S subunit, non-ATPase, 8; Psmd8; Rpn12; S14
• Common Name: PSMD8
• Gene Symbol: PSMD8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining