missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PSMD7 (aa 91-153) Control Fragment Recombinant Protein

Product Code. 30200403
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200403

Brand: Invitrogen™ RP103244

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Proteolytic degradation is critical to the maintenance of appropriate levels of short-lived and regulatory proteins as important and diverse as those involved in cellular metabolism, heat shock and stress response, antigen presentation, modulation of cell surface receptors and ion channels, cell cycle regulation, transcription, and signaling factors. The ubiquitin-proteasome pathway deconstructs most proteins in the eukaryotic cell cytosol and nucleus. Others are degraded via the vacuolar pathway which includes endosomes, lysosomes, and the endoplasmic reticulum. The 26S proteasome is an ATP-dependent, multisubunit (approximately 31), barrel-shaped molecular machine with an apparent molecular weight of approximately 2.5 MDa. It consists of a 20S proteolytic core complex which is crowned at one or both ends by 19S regulatory subunit complexes. The 19S regulatory subunits recognize ubiquitinated proteins and play an essential role in unfolding and translocating targets into the lumen of the 20S subunit. An enzymatic cascade is responsible for the attachment of multiple ubiquitin molecules to lysine residues of proteins targeted for degradation. Several genetic diseases are associated with defects in the ubiquitin-proteasome pathway. Some examples of affected proteins include those linked to cystic fibrosis, Angelman's syndrome, and Liddle syndrome.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P51665
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5713
Name Human PSMD7 (aa 91-153) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 26 S proteasome non-ATPase regulatory subunit 7; 26 S proteasome non-ATPase regulatory subunit 7-like protein; 26 S proteasome regulatory subunit rpn8; 26 S proteasome regulatory subunit S12; AW107203; Moloney leukemia virus-34 proviral integration; Mov34; Mov-34; Mov34 homolog; Mov34 protein; Mov34 protein homolog; MOV34L; P40; proteasome (prosome, macropain) 26 S subunit, non-ATPase, 7; proteasome (prosome, macropain) 26 S subunit, non-ATPase, 7 (Mov34 homolog); proteasome 26 S non-ATPase subunit 7; proteasome 26 S subunit, non-ATPase 7; proteasome subunit p40; Psmd7; Rpn8; S12; wu:fi03c01; zgc:55284
Common Name PSMD7
Gene Symbol Psmd7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.