Invitrogen™ Human PSMD2 (aa 313-404) Control Fragment Recombinant Protein

Product Code. 30194599

Brand: Invitrogen™ RP109017

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the non-ATPase subunits of the 19S regulator lid. In addition to participation in proteasome function, this subunit may also participate in the TNF signalling pathway since it interacts with the tumor necrosis factor type 1 receptor. A pseudogene has been identified on chromosome 1.

Specifications

• Accession Number: Q13200
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5708
• Name: Human PSMD2 (aa 313-404) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 26 S proteasome non-ATPase regulatory subunit 2; 26 S proteasome non-ATPase regulatory subunit 2-like protein; 26 S proteasome regulatory subunit RPN1; 26 S proteasome regulatory subunit S2; 26 S proteasome subunit p97; 55.11 protein; 9430095H01Rik; AA407121; F23F1.8; I79_017809; MGC14274; P97; proteasome (prosome, macropain) 26 S subunit, non-ATPase, 2; proteasome 26 S subunit, non-ATPase 2; protein 55.11; PSMD2; RPN1; S2; TEG-190; testis expressed gene 190; Te x 190; TNFR-associated protein 2; TRAP2; Tumor necrosis factor type 1 receptor-associated protein 2
• Common Name: PSMD2
• Gene Symbol: PSMD2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining