Invitrogen™ Human PSMD12 (aa 263-361) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30196883	100 μL	100µL

Product Code. 30196883 Supplier Invitrogen™ Supplier No. RP93548

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54701 (PA5-54701. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation. The encoded protein is found in many histone deacetylase complexes, including mSin3 co-repressor complex. It is also present in protein complexes involved in chromatin assembly. This protein can interact with BRCA1 tumor-suppressor gene and may have a role in the regulation of cell proliferation and differentiation.

Specifications

• Accession Number: O00232
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5718
• Name: Human PSMD12 (aa 263-361) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500002F15Rik; 26 S proteasome non-ATPase regulatory subunit 12; 26 S proteasome non-ATPase regulatory subunit 1-like protein; 26 S proteasome regulatory subunit p55; 26 S proteasome regulatory subunit RPN5; AI480719; fc34f08; MGC75406; P55; proteasome (prosome, macropain) 26 S subunit, non-ATPase, 12; proteasome 26 S non-ATPase subunit 12; proteasome 26 S subunit non-ATPase 12; proteasome 26 S subunit, non-ATPase 12; PSMD12; psmd12 protein; Rpn5; similar to proteasome 26 S non-ATPase subunit 12 isoform 2; wu:fb38a06; wu:fc34f08; wu:fc49f02
• Common Name: PSMD12
• Gene Symbol: PSMD12
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WQQALKSVVLYVILAPFDNEQSDLVHRISGDKKLEEIPKYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKRWKDLKNRVVEH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining