Invitrogen™ Human PSMB5 (aa 3-61) Control Fragment Recombinant Protein

Product Code. 30195476

Brand: Invitrogen™ RP105209

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cyclic nucleotide phosphodiesterases.

Specifications

• Accession Number: P28074
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5693
• Name: Human PSMB5 (aa 3-61) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: LMPX; Macropain epsilon chain; MB1; MGC118075; Multicatalytic endopeptidase complex epsilon chain; proteasome (prosome, macropain) subunit, beta type 5; proteasome (prosome, macropain) subunit, beta type, 5; proteasome 20 S subunit beta 5; proteasome beta 5 subunit; proteasome beta type subunit 5; proteasome catalytic subunit 3; proteasome chain 6; Proteasome epsilon chain; proteasome subunit beta 5; proteasome subunit beta type-5; Proteasome subunit MB1; proteasome subunit X; proteasome subunit, beta type, 5; PSMB5; PSX large multifunctional protease X; testicular tissue protein Li 153; Unknown (protein for MGC:134464); X
• Common Name: PSMB5
• Gene Symbol: PSMB5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining