Invitrogen™ Human PSMB4 (aa 116-257) Control Fragment Recombinant Protein

Product Code. 30195109

Brand: Invitrogen™ RP89179

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52328 (PA5-52328. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.

Specifications

• Accession Number: P28070
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5692
• Name: Human PSMB4 (aa 116-257) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 26 kDa prosomal protein; HN3; HsBPROS26; HsN3; Lmp3; Low molecular mass protein 3; macropain beta chain; Multicatalytic endopeptidase complex beta chain; PROS26; PROS-26; Pros-27; proteasome (prosome, macropain) subunit, beta type 4; proteasome (prosome, macropain) subunit, beta type, 4; proteasome beta 4 subunit; proteasome beta chain; Proteasome chain 3; proteasome subunit beta 4; proteasome subunit beta type-4; proteasome subunit HsN3; proteasome subunit, beta type, 4; Psmb4; RN3; testis tissue sperm-binding protein Li 79 P
• Common Name: PSMB4
• Gene Symbol: PSMB4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining