Invitrogen™ Human PSMA7 (aa 106-148) Control Fragment Recombinant Protein

Product Code. 30180722

Brand: Invitrogen™ RP99308

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (35%), Rat (35%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61483 (PA5-61483. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). Inhibits the transactivation function of HIF-1A under both normoxic and hypoxia-mimicking conditions. The interaction with EMAP2 increases the proteasome-mediated HIF-1A degradation under the hypoxic conditions. Plays a role in hepatitis C virus internal ribosome entry site-mediated translation. Mediates nuclear translocation of the androgen receptor (AR) and thereby enhances androgen-mediated transactivation.

Specifications

• Accession Number: O14818
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5688
• Name: Human PSMA7 (aa 106-148) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C6; C6-I; epididymis secretory protein Li 276; HEL-S-276; HSPC; proteasome (prosome, macropain) subunit, alpha type 7; proteasome (prosome, macropain) subunit, alpha type, 7; proteasome subunit alpha 4; proteasome subunit alpha 7; proteasome subunit alpha type-7; Proteasome subunit RC6-1; proteasome subunit XAPC7; Psma7; RC6-1; RP5-1005F21.4; testicular tissue protein Li 151; XAPC7
• Common Name: PSMA7
• Gene Symbol: PSMA7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YITRYIASLKQVGACPLACSPLAAGQSRLRHGGSCHVTSGESE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining