Invitrogen™ Human PSMA4 (aa 136-218) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30210889	100 μL	100µL

Product Code. 30210889 Supplier Invitrogen™ Supplier No. RP103378

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: P25789
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5685
• Name: Human PSMA4 (aa 136-218) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C9; HC9; HsT17706; LOW QUALITY PROTEIN: proteasome subunit alpha type-4; macropain subunit C9; MGC111191; MGC12467; MGC24813; Multicatalytic endopeptidase complex subunit C9; multicatalytic proteinase subunit L; proteasome (prosome, macropain) subunit, alpha type 4; proteasome (prosome, macropain) subunit, alpha type, 4; proteasome 20 S subunit alpha 4; proteasome alpha 4 subunit; proteasome component C9; proteasome subunit alpha 4; proteasome subunit alpha type-4; proteasome subunit alpha type-4-like protein; proteasome subunit HC9; proteasome subunit L; PSC9; PSMA 4; PSMA4; QtsA-10816; unnamed protein product; wu:fe05d10; zgc:56176
• Common Name: PSMA4
• Gene Symbol: Psma4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining