Invitrogen™ Human PSMA (aa 232-337) Control Fragment Recombinant Protein

Product Code. 30195578

Brand: Invitrogen™ RP90005

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82398 (PA5-82398. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. A mutation in this gene may be associated with impaired intestinal absorption of dietary folates, resulting in low blood folate levels and consequent hyperhomocysteinemia. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity. In the prostate the protein is up-regulated in cancerous cells and is used as an effective diagnostic and prognostic indicator of prostate cancer. This gene likely arose from a duplication event of a nearby chromosomal region. Alternative splicing gives rise to multiple transcript variants encoding several different isoforms.

Specifications

• Accession Number: Q04609
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2346
• Name: Human PSMA (aa 232-337) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Cell growth-inhibiting gene 27 protein; FGCP; folate hydrolase (prostate-specific membrane antigen) 1; folate hydrolase 1; FOLH; Folh1; Folylpoly-gamma-glutamate carboxypeptidase; GCP2; GCPII; GIG27; glutamate carboxylase II; glutamate carboxypeptidase 2; Glutamate carboxypeptidase II; membrane glutamate carboxypeptidase; mGCP; mopsm; Naalad; NAALAD1; NAALAdase; NAALADase I; N-acetylated alpha-linked acidic dipeptidase; N-acetylated alpha-linked acidic dipeptidase 1; N-acetylated-alpha-linked acidic dipeptidase I; prostate specific membrane antigen; prostate specific membrane antigen variant F; prostate-specific membrane antigen; Prostate-specific membrane antigen homolog; PSM; PSMA; pteroylpoly-gamma-glutamate carboxypeptidase
• Common Name: PSMA
• Gene Symbol: FOLH1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining