Invitrogen™ Human PSCA (aa 12-109) Control Fragment Recombinant Protein

Product Code. 30195640

Brand: Invitrogen™ RP105840

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65080 (PA5-65080. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PSCA (Prostate Stem Cell antigen) is a cell surface antigen, which is overexpressed in approximately40% of primary prostate cancers and in as many as 100% of metastatic ones. PSCA is also overexpressed in a majority of transitional cell and pancreatic carcinomas. Antibody directed against PSCA inhibits tumorigenesis, slows tumor growth, prolongs survival and prevents metastasis in a preclinical zenograft model indicating that PSCA may have utility as a prognostic marker and/or therapeutic target in prostate cancer.

Specifications

• Accession Number: O43653
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8000
• Name: Human PSCA (aa 12-109) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2210408B04Rik; caldesmon; CDM; HCAD; H-CAD; LCAD; L-CAD; NAG22; PRO232; prostate stem cell antigen; PSCA; UNQ206; UNQ206/PRO232
• Common Name: PSCA
• Gene Symbol: PSCA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining