Invitrogen™ Human PSAP (aa 214-356) Control Fragment Recombinant Protein

Product Code. 30213265

Brand: Invitrogen™ RP102428

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (51%), Rat (51%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82153 (PA5-82153. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PSAP is a highly conserved glycoprotein which is a precursor for 4 cleavage products: saposins A, B, C, and D. Each domain of the precursor protein is approximately 80 amino acid residues long with nearly identical placement of cysteine residues and glycosylation sites. Saposins A-D localize primarily to the lysosomal compartment where they facilitate the catabolism of glycosphingolipids with short oligosaccharide groups. The precursor protein exists both as a secretory protein and as an integral membrane protein and has neurotrophic activities.

Specifications

• Accession Number: P07602
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5660
• Name: Human PSAP (aa 214-356) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A1 activator; AI037048; Cerebroside sulfate activator; Co-beta-glucosidase; Component C; CSAct; Dispersin; GLBA; Glucosylceramidase activator; Proactivator polypeptide; prosaposin; prosaposin (sulfated glycoprotein, sphingolipid hydrolase activator); Protein A; Protein C; Psap; SAP1; SAP-1; SAP-2; Saposin-A; Saposin-B; Saposin-B-Val; Saposin-C; Saposin-D; Sgp1; SGP-1; SGP1A; snoRNA MBII-198; Sphingolipid activator protein 1; Sphingolipid activator protein 2; sphingolipid activator protein-1; sulfated glycoprotein 1; Sulfatide/GM1 activator
• Common Name: PSAP
• Gene Symbol: Psap
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining