Invitrogen™ Human PRUNE2 (aa 2298-2437) Control Fragment Recombinant Protein

Product Code. 30193783

Brand: Invitrogen™ RP110173

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144721 (PA5-144721. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PRUNE2 gene, also named BMCC1, encodes protein prune homolog 2. PRUNE2 gene are overlapping with PCA3, one of the most prostate cancer specific markers. PRUNE2 may play an important role in regulating differentiation, survival and aggressiveness of the tumor cells. Besides its high level of expression seen in the nervous system (brain, cerebellum and spinal cord), it is also expressed at high levels in noneuroblastoma, rhabdomyosarcoma, melanoma and some osteosarcoma cell lines, whereas at only low levels in cancer cell lines of liver, breast, thyroid and colon. The Calculated molecular weight of this protein is 340 kDa.

Specifications

• Accession Number: Q8WUY3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 158471
• Name: Human PRUNE2 (aa 2298-2437) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6330414G02Rik; A214N16.3; A230083H22Rik; A330102H22Rik; bA214N16.3; BCH motif-containing molecule at the carboxyl terminal region 1; Bmcc1; BNIP2 motif containing molecule at the carboxyl terminal region 1; BNIP2 motif-containing molecule at the C-terminal region 1; BNIPXL; C9orf65; DKFZp762K117; KIAA0367; mKIAA0367; neuronal protein; olfaxin; protein prune homolog 2; prune homolog 2; prune homolog 2 (Drosophila); PRUNE2; RGD1311350; RP11-214N16.3; RP11-58J3.2; truncated PRUNE2
• Common Name: PRUNE2
• Gene Symbol: PRUNE2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AFDHSFSDASGLNTSTGTIDDMSKLTLSEGHPETPVDGDLGKQDICSSEASWGDFEYDVMGQNIDEDLLREPEHFLYGGDPPLEEDSLKQSLAPYTPPFDLSYLTEPAQSAETIEEAGSPEDESLGCRAAEIVLSALPDR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining