Invitrogen™ Human PRSS54 (aa 37-128) Control Fragment Recombinant Protein

Product Code. 30181803

Brand: Invitrogen™ RP98546

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59619 (PA5-59619. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a putative serine-type endopeptidase containing the peptidase S1 domain. Alternative splicing of this gene results in multiple transcript variants.

Specifications

• Accession Number: Q6PEW0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 221191
• Name: Human PRSS54 (aa 37-128) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4931432M23Rik; Cancer/testis antigen 67; CT67; Inactive serine protease 54; Klkbl4; Plasma kallikrein-like protein 4; protease, serine 54; protease, serine, 54; PRSS54; testis tissue sperm-binding protein Li 40 A
• Common Name: PRSS54
• Gene Symbol: PRSS54
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VFYGPDPKEGLVSSMEFPWVVSLQDSQYTHLAFGCILSEFWVLSIASAIQNRKDIVVIVGISNMDPSKIAHTEYPVNTIIIHEDFDNNSMSN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining