Invitrogen™ Human PRSS23 (aa 27-113) Control Fragment Recombinant Protein

Product Code. 30197333

Brand: Invitrogen™ RP95860

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56516 (PA5-56516. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: O95084
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11098
• Name: Human PRSS23 (aa 27-113) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: protease, serine 23; protease, serine, 23; PRSS23; Putative secreted protein Zsig13; serine protease 23; serine protease, umbilical endothelium; SIG13; SPUVE; UNQ270/PRO307; ZSIG13
• Common Name: PRSS23
• Gene Symbol: PRSS23
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PWKPTWPAYRLPVVLPQSTLNLAKPDFGAEAKLEVSSSCGPQCHKGTPLPTYEEAKQYLSYETLYANGSRTETQVGIYILSSSGDGA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining