Invitrogen™ Human PRSS16 (aa 324-431) Control Fragment Recombinant Protein

Product Code. 30196862

Brand: Invitrogen™ RP89254

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53632 (PA5-53632. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a serine protease expressed exclusively in the thymus. It is thought to play a role in the alternative antigen presenting pathway used by cortical thymic epithelial cells during the positive selection of T cells.

Specifications

• Accession Number: Q9NQE7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10279
• Name: Human PRSS16 (aa 324-431) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI448615; FLJ36271; FLJ40714; FLJ44172; protease, serine 16; protease, serine 16 (thymus); protease, serine, 16; protease, serine, 16 (thymus); Prss16; Serine protease 16; thymus specific serine peptidase; thymus-specific serine protease; Tssp
• Common Name: PRSS16
• Gene Symbol: PRSS16
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQWLYQTCTEFGFYVTCENPRCPFSQLPALPSQLDLCEQVFGLSALSVAQAVAQTNSYYGG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining