missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PRRX2 (aa 156-253) Control Fragment Recombinant Protein

Product Code. 30193534
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30193534 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30193534 Supplier Invitrogen™ Supplier No. RP89393

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-110708 (PA5-110708, PA5-55423 (PA5-55423. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The paired-class homeobox genes PRX1 and PRX2 are necessary for craniofacial and limb development and are expressed in similar patterns in the cranial mesenchyme, limb buds, axial mesoderm and branchial arches. These proteins exhibit different patterns of expression, however, in heart and brain tissue. Specifically, PRX1 is expressed in the endocardial cusions, semilunar and atrioventricular valves, whereas PRX2 is initially expressed in a diffuse myocardial pattern and is later expressed in the ventricular septum. Furthermore, PRX2 is never expressed in the brain, whereas PRX1 is expressed in the ventral hypothalamus and in the telencephalon. Murine mutants lacking PRX1 function demonstrate skeletal defects in the skull, limbs, and vertebral column. Mice lacking functional PRX2 alone do not demonstrate skeletal abnormalities, however, PRX1/PRX2 double mutants demonstrate novel abnormalities that are not visualized with the PRX1-deficient mice. Transcripts of neither PRX1 nor PRX2 are detected in normal adult rat pulmonary arteries, however vascular disease induces PRX gene expression wherein they co-localize to sites of Tenascin-C expression.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q99811
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51450
Name Human PRRX2 (aa 156-253) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias homeo box of paired rule; homeobox protein S8; LOW QUALITY PROTEIN: paired mesoderm homeobox protein 2; MGC19843; paired mesoderm homeobox protein 2; paired related homeobox 2; paired-like homeodomain protein PRX2; paired-related homeobox protein 2; PMX2; PRRX2; Prx2; PRX-2; S8; surface antigen, homeo box of paired rule; testicular tissue protein Li 148; testicular tissue protein Li 160
Common Name PRRX2
Gene Symbol Prrx2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.