Invitrogen™ Human PRRX2 (aa 156-253) Control Fragment Recombinant Protein

Product Code. 30193534

Brand: Invitrogen™ RP89393

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-110708 (PA5-110708, PA5-55423 (PA5-55423. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The paired-class homeobox genes PRX1 and PRX2 are necessary for craniofacial and limb development and are expressed in similar patterns in the cranial mesenchyme, limb buds, axial mesoderm and branchial arches. These proteins exhibit different patterns of expression, however, in heart and brain tissue. Specifically, PRX1 is expressed in the endocardial cusions, semilunar and atrioventricular valves, whereas PRX2 is initially expressed in a diffuse myocardial pattern and is later expressed in the ventricular septum. Furthermore, PRX2 is never expressed in the brain, whereas PRX1 is expressed in the ventral hypothalamus and in the telencephalon. Murine mutants lacking PRX1 function demonstrate skeletal defects in the skull, limbs, and vertebral column. Mice lacking functional PRX2 alone do not demonstrate skeletal abnormalities, however, PRX1/PRX2 double mutants demonstrate novel abnormalities that are not visualized with the PRX1-deficient mice. Transcripts of neither PRX1 nor PRX2 are detected in normal adult rat pulmonary arteries, however vascular disease induces PRX gene expression wherein they co-localize to sites of Tenascin-C expression.

Specifications

• Accession Number: Q99811
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51450
• Name: Human PRRX2 (aa 156-253) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: homeo box of paired rule; homeobox protein S8; LOW QUALITY PROTEIN: paired mesoderm homeobox protein 2; MGC19843; paired mesoderm homeobox protein 2; paired related homeobox 2; paired-like homeodomain protein PRX2; paired-related homeobox protein 2; PMX2; PRRX2; Prx2; PRX-2; S8; surface antigen, homeo box of paired rule; testicular tissue protein Li 148; testicular tissue protein Li 160
• Common Name: PRRX2
• Gene Symbol: Prrx2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining