Invitrogen™ Human PRRX1 (aa 152-211) Control Fragment Recombinant Protein

Product Code. 30196484

Brand: Invitrogen™ RP108489

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111567 (PA5-111567. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The homeobox DNA-binding domain is a 60 amino acid motif that is conserved among many species and functions to bind DNA via a helix-turn-helix structure, thereby playing a role in transcriptional regulation and the control of gene expression. PRX1 (paired related homeobox 1), also known as PRRX1, PMX1 or PHOX1, is a 245 amino acid protein that contains one OAR domain and one homeobox DNA-binding domain and belongs to the paired homeobox family. Localized to the nucleus, PRX1 functions as a transcriptional co-activator that enhances the DNA-binding activity of serum response factor (SRF), thereby mediating the induction of SRF-dependent gene expression by growth and differentiation factors. Additionally, PRX1 regulates the transcriptional activities of creatine kinase-M (muscle), thereby playing a role in the establishment of mesodermal muscle types. PRX1 exists as two alternatively spliced isoforms, designated PMX1-A and PMX1-B.

Specifications

• Accession Number: P54821
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5396
• Name: Human PRRX1 (aa 152-211) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A230024N07Rik; AA755424; AGOTC; AI385634; AI843499; Homeobox protein K-2; homeobox protein mHox; Homeobox protein PHO x 1; K-2; mHox; paired mesoderm homeobox 1; paired mesoderm homeobox 1 isoform pmx-1 b; paired mesoderm homeobox protein 1; paired related homeobox 1; paired-related homeobox protein 1; PHO x 1; Pmx; Pm x 1; Prr x 1; Pr x 1; PRX-1; rHox
• Common Name: PRRX1
• Gene Symbol: PRRX1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYRSSSLPRCCLHE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining