Invitrogen™ Human PRRT2 (aa 152-268) Control Fragment Recombinant Protein

Product Code. 30213126

Brand: Invitrogen™ RP91025

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-53168 (PA5-53168, PA5-64976 (PA5-64976. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The proline-rich transmembrane protein 2 (PRRT2) contains a proline-rich domain in its N-terminal half and is predominantly expressed in brain and spinal cord in embryonic and postnatal stages. While little is known of the function of this protein, mutations in PRRT2 have been shown to be the causative gene of paroxysmal kinesigenic dyskinesia, which is characterized by recurrent, brief attacks of abnormal involuntary movements induced by sudden voluntary movements. Recent studies have shown that PRRT2 may also be involved in some forms of benign familial infantile epilepsy (BFIE), an autosomal dominant epilepsy syndrome.

Specifications

• Accession Number: Q7Z6L0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 112476
• Name: Human PRRT2 (aa 152-268) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500031I19Rik; AI195361; BFIC2; BFIS2; Dispanin subfamily B member 3; DSPB3; dystonia 10; DYT10; EKD1; FICCA; ICCA; IFITMD1; infantile convulsions and paroxysmal choreoathetosis; interferon induced transmembrane protein domain containing 1; PKC; proline rich transmembrane protein 2; proline-rich transmembrane protein 2; PRRT2; RGD1564195
• Common Name: PRRT2
• Gene Symbol: PRRT2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PKPALQPELPTQEDPTPEILSESVGEKQENGAVVPLQAGDGEEGPAPEPHSPPSKKSPPANGAPPRVLQQLVEEDRMRRAHSGHPGSPRGSLSRHPSSQLAGPGVEGGEGTQKPRDY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining