Invitrogen™ Human PRRG3 (aa 48-81) Control Fragment Recombinant Protein

Product Code. 30205087

Brand: Invitrogen™ RP101270

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63879 (PA5-63879. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein which contains a vitamin K-dependent carboxylation/gamma-carboxyglutamic domain. The encoded protein is a member of a family of vitamin K-dependent transmembrane proteins which contain a glutamate-rich extracellular domain.

Specifications

• Accession Number: Q9BZD7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79057
• Name: Human PRRG3 (aa 48-81) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Gm368; PRGP3; proline rich and Gla domain 3; proline rich Gla (G-carboxyglutamic acid) 3 (transmembrane); proline-rich gamma-carboxyglutamic acid protein 3; Proline-rich Gla protein 3; Prrg3; RGD1560309; Tmg3; transmembrane gamma-carboxyglutamic acid protein 3
• Common Name: PRRG3
• Gene Symbol: PRRG3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EVFENKEKTMEFWKGYPNAVYSVRDPSQSSDAMY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining