Invitrogen™ Human PRRC2C (aa 1946-2034) Control Fragment Recombinant Protein

Product Code. 30195606

Brand: Invitrogen™ RP94126

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55936 (PA5-55936. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Proline-rich coiled-coil 2C (PRRC2C) is proposed to be involved in protein C-terminus binding and contains a conserved BAT2 N-terminus domain.

Specifications

• Accession Number: Q9Y520
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23215
• Name: Human PRRC2C (aa 1946-2034) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BAT2 domain containing 1; BAT2 domain-containing protein 1; BAT2D1; BAT2-iso; BAT2L2; HBV XAg-transactivated protein 2; HBV X-transactivated gene 2 protein; HBxAg transactivated protein 2; HLA-B associated transcript 2-like 2; HLA-B-associated transcript 2-like 2; KIAA1096; proline rich coiled-coil 2 C; proline-rich and coiled-coil-containing protein 2 C; proline-rich coiled-coil 2 C; protein BAT2-like 2; protein PRRC2C; PRRC2C; XTP2
• Common Name: PRRC2C
• Gene Symbol: PRRC2C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TTSQSSKQPPPSIRLPSAQTPNGTDYVASGKSIQTPQSHGTLTAELWDNKVAPPAVLNDISKKLGPISPPQPPSVSAWNKPLTSFGSAP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining