Invitrogen™ Human PRRC2B (aa 778-877) Control Fragment Recombinant Protein

Product Code. 30195343

Brand: Invitrogen™ RP107325

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66677 (PA5-66677. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PRRC2B (Proline Rich Coiled-Coil 2B) is a Protein Coding gene. An important paralog of this gene isPRRC2C.

Specifications

• Accession Number: Q5JSZ5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84726
• Name: Human PRRC2B (aa 778-877) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5830434P21Rik; AI173903; BAT2L; Bat2l1; D430039P21; HLA-B associated transcript 2-like 1; HLA-B-associated transcript 2-like 1; Kiaa0515; LQFBS-1; mKIAA0515; proline rich coiled-coil 2 B; proline-rich coiled-coil 2 B; proline-rich coiled-coil protein 2 B; protein BAT2-like 1; protein PRRC2B; PRRC2B
• Common Name: PRRC2B
• Gene Symbol: PRRC2B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSFSASLGRAGGVSAQRDLFEERGEEYLSAFDKKAQADFDSCISSQRIGQELLFPPQENVQDAGAPGGHTQNLRCSPLEPDFVPDEKKPECGSWDVSHQP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining