Invitrogen™ Human PRR15L (aa 4-94) Control Fragment Recombinant Protein

Product Code. 30208782

Brand: Invitrogen™ RP93383

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54635 (PA5-54635. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function of this protein remains unknown.

Specifications

• Accession Number: Q9BU68
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79170
• Name: Human PRR15L (aa 4-94) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ATAD4; ATPase family, AAA domain containing 4; proline rich 15 like; proline rich 15-like; proline-rich protein 15-like protein; Protein ATAD4; PRR15L; testicular tissue protein Li 157
• Common Name: PRR15L
• Gene Symbol: PRR15L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EIGWWKLTFLRKKKSTPKVLYEIPDTYAQTEGDAEPPRPDAGGPNSDFNTRLEKIVDKSTKGKHVKVSNSGRFKEKKKVRATLAENPNLFD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining