missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PRPF4B Partial ORF (NP_003904.2, 898 a.a. - 1005 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00008899-Q02.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16075095

  • £425.00 / 25µg
Estimated Shipment: 09-01-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Pre-mRNA splicing occurs in two sequential transesterification steps, and the protein encoded by this gene is thought to be involved in pre-mRNA splicing and in signal transduction. This protein belongs to a kinase family that includes serine/arginine-rich protein-specific kinases and cyclin-dependent kinases (CDKs). This protein is regarded as a CDK-like kinase (Clk) with homology to mitogen-activated protein kinases (MAPKs). [provided by RefSeq]

Sequence: LKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQE
Specifications

Specifications

NP_003904.2
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.62kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQE
RUO
PRPF4B
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
8899
PRPF4B (Human) Recombinant Protein (Q02)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KIAA0536/PR4H/PRP4/PRP4H/PRP4K/dJ1013A10.1
PRPF4B
Recombinant
wheat germ expression system
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers