Invitrogen™ Human PRPF40B (aa 792-850) Control Fragment Recombinant Protein

Product Code. 30181172

Brand: Invitrogen™ RP97671

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58386 (PA5-58386. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q6NWY9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25766
• Name: Human PRPF40B (aa 792-850) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610317D23Rik; Huntingtin interacting protein C; huntingtin yeast partner C; Huntingtin-interacting protein C; huntington yeast partner C; Hypc; pre-mRNA processing factor 40 homolog B; pre-mRNA-processing factor 40 homolog B; PRP40 pre-mRNA processing factor 40 homolog A; PRP40 pre-mRNA processing factor 40 homolog B; PRP40 pre-mRNA processing factor 40 homolog B (S. cerevisiae); PRP40 pre-mRNA processing factor 40 homolog B (yeast); Prpf40b; RGD1565411
• Common Name: PRPF40B
• Gene Symbol: PRPF40B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KSNSPESETDPEEKAGKESDEKEQEQDKDRELQQAELPNRSPGFGIKKEKTGWDTSESE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining