missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PRPF40A (aa 297-374) Control Fragment Recombinant Protein

Product Code. 30203476
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203476

Brand: Invitrogen™ RP96227

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58320 (PA5-58320. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FNBP3, Formin-binding protein 3, is a 957 amino acid protein encoded by the human gene PRPF40A. FNBP3 belongs to the PRPF40 family and contains five FF domains and two WW domains. Nuclear proteins harboring both WW and FF protein interaction modules bind to splicing factors as well as RNA polymerase II and may serve to link transcription with splicing. Through the WW domains, FNBP3 will bind to the Formin proline-rich regions. Also known as Pre-mRNA-processing factor 40 homolog A, FNBP3 binds to WASL/N-WASP (Neuronal Wiskott-Aldrich syndrome protein) complex and suppresses its translocation from the nucleus to the cytoplasm, thereby inhibiting its cytoplasmic function. FNBP3 is widely expressed in most tissues and is localized to the nuclear speckles.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75400
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55660
Name Human PRPF40A (aa 297-374) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810012K09Rik; Fas ligand-associated factor 1; Fas-ligand associated factor 1; FBP11; FBP-11; FLAF1; FLJ20585; Fnbp11; Fnbp3; formin binding protein 11; formin binding protein 3; formin-binding protein 11; Formin-binding protein 3; HIP10; HIP-10; HSPC225; Huntingtin yeast partner A; huntingtin-interacting protein 10; Huntingtin-interacting protein A; HYPA; NY-REN-6; NY-REN-6 antigen; pre-mRNA processing factor 40 homolog A; pre-mRNA-processing factor 40 homolog A; Prp40; PRP40 pre-mRNA processing factor 40 homolog A; PRP40 pre-mRNA processing factor 40 homolog A (S. cerevisiae); PRP40 pre-mRNA processing factor 40 homolog A (yeast); PRPF40A; Renal carcinoma antigen NY-REN-6
Common Name PRPF40A
Gene Symbol PRPF40A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NASTSASNTVSGTVPVVPEPEVTSIVATVVDNENTVTISTEEQAQLTSTPAIQDQSVEVSSNTGEETSKQETVADFTP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.