Invitrogen™ Human PRP19 (aa 293-374) Control Fragment Recombinant Protein

Product Code. 30197795

Brand: Invitrogen™ RP102801

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83399 (PA5-83399. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PSO4 is the human homolog of yeast Pso4, a gene essential for cell survival and DNA repair.

Specifications

• Accession Number: Q9UMS4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 27339
• Name: Human PRP19 (aa 293-374) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA617263; AL024362; D19Wsu55e; hPSO4; Neuronal differentiation-related gene protein; NMP200; Nuclear matrix protein 200; nuclear matrix protein NMP200 related to splicing factor PRP19; nuclear matrix protein SNEV; pre-mRNA processing factor 19; pre-mRNA-processing factor 19; PRP19; prp19 beta; PRP19/PSO4 homolog; PRP19/PSO4 pre-mRNA processing factor 19 homolog; PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae); PRPF19; PSO4; psoralen 4; RING-type E3 ubiquitin transferase PRP19; Senescence evasion factor; SNEV; UBO x 4
• Common Name: PRP19
• Gene Symbol: Prpf19
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTMDSQI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining