Invitrogen™ Human Protease-Activated Receptor-4 (aa 344-385) Control Fragment Recombinant Protein

Product Code. 30209915

Brand: Invitrogen™ RP108838

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (52%), Rat (52%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Coagulation factor II (thrombin) receptor-like 3 (F2RL3) is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL3 is also a member of the protease-activated receptor family. F2RL3 is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. F2RL3 is activated by thrombin and trypsin.

Specifications

• Accession Number: Q96RI0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9002
• Name: Human Protease-Activated Receptor-4 (aa 344-385) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: coagulation factor II (thrombin) receptor-like 3; coagulation factor II receptor-like 3; F2R like thrombin/trypsin receptor 3; F2rl3; PAR4; PAR-4; protease-activated receptor 4; protease-activated receptor-4; proteinase-activated receptor 4; Thrombin receptor-like 3
• Common Name: Protease-Activated Receptor-4
• Gene Symbol: F2RL3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining