Invitrogen™ Human PROSER1 (aa 36-135) Control Fragment Recombinant Protein

Product Code. 30203224

Brand: Invitrogen™ RP103228

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63159 (PA5-63159. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a conserved protein containing proline and serine rich regions. These regions may be important in protein-protein interactions.

Specifications

• Accession Number: Q86XN7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80209
• Name: Human PROSER1 (aa 36-135) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810046L04Rik; 9330161F11; C13orf23; KIAA2032; proline and serine rich 1; proline and serine-rich protein 1; PROSER1
• Common Name: PROSER1
• Gene Symbol: PROSER1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EQVVDLLRYFSWAEPQLKAMKALQHKMVAVQPTEVVNILNCFTFSKDKLVALELLASNIIDAQNSRPIEDLFRVNMSEKKRCKRILEQAFKGGCKAPHAM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining