Invitrogen™ Human Progestin Receptor beta (aa 1-50) Control Fragment Recombinant Protein

Product Code. 30209649

Brand: Invitrogen™ RP105324

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Progestin Receptor Beta-extra recognizes the extracellular epitope of the membrane progestin receptor. Progestin receptors with are found in pituitary, reproductive tract and most estrogen receptor-containing brain regions; these receptors are inducible by estrogen treatment. There are also progestin receptor sites in brain areas lacking estrogen receptors, such as the cerebral cortex of the rat; these receptors are not induced by estradiol treatment. Nevertheless, such receptors resemble those induced by estradiol. Another inducer of progestin receptors in brain is testosterone, which works through its conversion to estradiol via aromatization.

Specifications

• Accession Number: Q8TEZ7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 85315
• Name: Human Progestin Receptor beta (aa 1-50) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700019B16Rik; 3110001D06Rik; C6orf33; LMPB1; Lysosomal membrane protein in brain 1; lysosomal membrane protein in brain-1; Membrane progesterone P4 receptor beta; Membrane progesterone receptor beta; Membrane progestin receptor beta; mPR beta; MPRB; mSR; Paqr8; Pmrbeta; PR; Progesterone and adipoQ receptor family member 8; Progestin and adipoQ receptor family member 8; progestin and adipoQ receptor family member VIII; progestin membrane receptor beta; putative membrane steroid receptor; RGD1311710
• Common Name: Progestin Receptor beta
• Gene Symbol: PAQR8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining