missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Progesterone Receptor (aa 323-419) Control Fragment Recombinant Protein

Product Code. 30198044
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198044

Brand: Invitrogen™ RP89196

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82350 (PA5-82350. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The progesterone receptor (PR) is a member of the steroid family of nuclear receptors. The PR mediates the physiological effects of progesterone, which plays a central role in reproductive events associated with the establishment and maintenance of pregnancy. PR is found as a 94 kDa protein (Form A) or a 120 kDa protein (Form B) due to the use of alternative translation initiation sites. PR-B is the transcriptionally active form and is responsible for activating genes for the maintenance of the endometrium, maintenance of pregnancy, and inhibition of ovulation. PR-A is identical to PR-B except for a 165 amino acid deletion at the N-terminus. This deletion exposes a 140 amino acid inhibitory domain (ID) that acts as a repressor of steroid hormone transcriptional activity. In its inactive state, PgR forms a multiprotein complex which includes heat shock proteins and immunophins. Upon binding of progesterone hormone to its receptor, there is a conformational change that allows dimerization and binding of the receptor to progesterone response elements (PRE) sequences, resulting in activated transcription. A Null mutation in the PGR gene leads to pleiotrophic reproductive abnormalities.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P06401
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5241
Name Human Progesterone Receptor (aa 323-419) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9930019P03Rik; BB114106; ENSMUSG00000074510; LOW QUALITY PROTEIN: progesterone receptor; NR3C3; Nuclear receptor subfamily 3 group C member 3; p4 receptor; PGR; pot. alt. progesterone receptor; putative; PR; PR-A; PR-B; Progesterone receptor; progesterone receptor A; progesterone-receptor; putative form B; steroid hormone receptor; testicular progesterone receptor; unnamed protein product
Common Name Progesterone Receptor
Gene Symbol PGR
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPDCAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.