Invitrogen™ Human PRMT4 (aa 76-160) Control Fragment Recombinant Protein

Product Code. 30202406

Brand: Invitrogen™ RP106047

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein arginine N-methyltransferases, such as CARM1, catalyze the transfer of a methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins to form methylated arginine derivatives and S-adenosyl-L-homocysteine. Protein arginine methylation has been implicated in DNA packaging, transcription regulation, signal transduction, mRNA stability, metabolism of nascent pre-RNA, and transcriptional activation. Tissue specificity: Overexpressed in prostate adenocarcinomas and high-grade prostatic intraepithelial neoplasia.

Specifications

• Accession Number: Q86X55
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10498
• Name: Human PRMT4 (aa 76-160) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Carm1; coactivator associated arginine methyltransferase 1; coactivator-associated arginine methyltransferase 1; coactivator-associated arginine methyltransferase 1 variant 5; histone-arginine methyltransferase CARM1; PRMT4; protein arginine methyltransferase; protein arginine N-methyltransferase 4
• Common Name: PRMT4
• Gene Symbol: Carm1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DVCVFKCSVSRETECSRVGKQSFIITLGCNSVLIQFATPNDFCSFYNILKTCRGHTLERSVFSERTEESSAVQYFQFYGYLSQQQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining