Invitrogen™ Human PRMT1 (aa 15-53) Control Fragment Recombinant Protein

Product Code. 30210941

Brand: Invitrogen™ RP105554

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PRMT1 is a member of the protein arginine N-methyltransferase (PRMT) family. Arginine methylation is an irreversible post translational modification which has been implicated in RNA processing and trafficking, receptor-mediated signaling, and transcription. At least three types of PRMT enzymes have been identified in mammalian cells. These enzymes have been shown to have essential regulatory functions by methylation of key proteins in several fundamental areas. These proteins include nuclear proteins, IL enhancer binding factor, nuclear factors, cell cycle proteins, signal transduction proteins, apoptosis proteins, and viral proteins. The mammalian PRMT family currently consists of 7 members that share two large domains of homology. Increased expression of PRMT1 may play a role in various types of cancer.

Specifications

• Accession Number: Q99873
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3276
• Name: Human PRMT1 (aa 15-53) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6720434D09Rik; ANM1; arginine N-methyltransferase 1; AW214366; HCP1; heterogeneous nuclear ribonucleoprotein methyltransferase 1-like 2; heterogeneous nuclear ribonucleoproteins methyltransferase-like 2; histone-arginine N-methyltransferase PRMT1; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 2; HMT1 hnRNP methyltransferase-like 2; HMT1 hnRNP methyltransferase-like 2 isoform 3; HMT2; Hrmt1l2; interferon receptor 1-bound protein 4; IR1B4; Mrmt1; PRMT1; protein arginine methyltransferase 1; protein arginine N-methyltransferase 1
• Common Name: PRMT1
• Gene Symbol: PRMT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining