Invitrogen™ Human PRKD2 (aa 811-878) Control Fragment Recombinant Protein

Product Code. 30203141

Brand: Invitrogen™ RP92378

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82764 (PA5-82764. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PRKD2 (PKD2) is a member of the protein kinase D serine/threonine protein kinase family. PRKD2 is a component in the signal transduction pathway induced by phorbol esters and the CCK b gastrin receptor. It exhibits the strongest homology to the serine threonine protein kinases PKD/PKC and PKCnu, particularly in the duplex zinc finger-like cysteine-rich motif, in the pleckstrin homology domain and in the protein kinase domain. In contrast, it shows only a low degree of sequence similarity to other members of the PKC family.

Specifications

• Accession Number: Q9BZL6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25865
• Name: Human PRKD2 (aa 811-878) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI325941; HSPC187; nPKC-D2; PKD2; Prkd2; protein kinase D2; RGD1308054; serine/threonine-protein kinase D2
• Common Name: PRKD2
• Gene Symbol: PRKD2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QTWLDLRELEGKMGERYITHESDDARWEQFAAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining