missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PRKAR2A (aa 269-331) Control Fragment Recombinant Protein

Product Code. 30211412
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211412

Brand: Invitrogen™ RP102819

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83406 (PA5-83406. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase (AMPK), which transduces the signal through phosphorylation of different target proteins. The inactive holoenzyme of AMPK is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits of AMPK have been identified in humans. The protein encoded by this gene is one of the regulatory subunits. This subunit can be phosphorylated by the activated catalytic subunit. It may interact with various A-kinase anchoring proteins and determine the subcellular localization of AMPK.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P13861
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5576
Name Human PRKAR2A (aa 269-331) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110061A24Rik; AI317181; AI836829; cAMP-dependent protein kinase regulatory subunit RII alpha; cAMP-dependent protein kinase type II-alpha regulatory subunit; cAMP-dependent protein kinase, regulatory subunit alpha 2; MGC3606; PKR2; PRKAR2; Prkar2a; protein kinase A, RII-alpha subunit; protein kinase cAMP-dependent regulatory type II alpha; protein kinase cAMP-dependent type II regulatory subunit alpha; protein kinase, cAMP dependent regulatory, type II alpha; protein kinase, cAMP-dependent, regulatory subunit type II alpha; protein kinase, cAMP-dependent, regulatory, type 2, alpha; protein kinase, cAMP-dependent, regulatory, type II, alpha; RII(alpha); unnamed protein product
Common Name PRKAR2A
Gene Symbol PRKAR2A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.