Invitrogen™ Human PRKAR2A (aa 269-331) Control Fragment Recombinant Protein

Product Code. 30211412

Brand: Invitrogen™ RP102819

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83406 (PA5-83406. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase (AMPK), which transduces the signal through phosphorylation of different target proteins. The inactive holoenzyme of AMPK is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits of AMPK have been identified in humans. The protein encoded by this gene is one of the regulatory subunits. This subunit can be phosphorylated by the activated catalytic subunit. It may interact with various A-kinase anchoring proteins and determine the subcellular localization of AMPK.

Specifications

• Accession Number: P13861
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5576
• Name: Human PRKAR2A (aa 269-331) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110061A24Rik; AI317181; AI836829; cAMP-dependent protein kinase regulatory subunit RII alpha; cAMP-dependent protein kinase type II-alpha regulatory subunit; cAMP-dependent protein kinase, regulatory subunit alpha 2; MGC3606; PKR2; PRKAR2; Prkar2a; protein kinase A, RII-alpha subunit; protein kinase cAMP-dependent regulatory type II alpha; protein kinase cAMP-dependent type II regulatory subunit alpha; protein kinase, cAMP dependent regulatory, type II alpha; protein kinase, cAMP-dependent, regulatory subunit type II alpha; protein kinase, cAMP-dependent, regulatory, type 2, alpha; protein kinase, cAMP-dependent, regulatory, type II, alpha; RII(alpha); unnamed protein product
• Common Name: PRKAR2A
• Gene Symbol: PRKAR2A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining