missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PRKAR1B (aa 28-85) Control Fragment Recombinant Protein

Product Code. 30211268
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211268

Brand: Invitrogen™ RP92833

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55392 (PA5-55392. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The second messenger cyclic AMP (cAMP) mediates diverse cellular responses to external signals such as proliferation, ion transport, regulation of metabolism and gene transcription by activation of the cAMP-dependent protein kinase (cAPK or PKA). Activation of PKA occurs when cAMP binds to the two regulatory subunits of the tetrameric PKA holoenzyme resulting in release of active catalytic subunits. Three catalytic (C) subunits have been identified that each represent specific gene products. Activation of transcription upon elevation of cAMP levels results from translocation of PKA to the nucleus where it phosphorylates the transcrip- tion factor cAMP response element binding protein (CREB) on serine 133 which in turn leads to TFIIB binding to TATA-box-binding protein TBP1, thus linking phospho-CREB to the pol II transcription initiation complex.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P31321
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5575
Name Human PRKAR1B (aa 28-85) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI385716; cAMP dependent protein kinase, subunit type 1 beta; cAMP dependent regulatory type I beta subunit transcript 2; cAMP dependent regulatory type I beta subunit transcript 3; cAMP dependent regulatory type I beta subunit transcript 4; cAMP-dependent protein kinase type I-beta regulatory subunit; PRKAR1; PRKAR1B; protein kinase cAMP-dependent type I regulatory subunit beta; protein kinase, cAMP dependent regulatory, type I beta; protein kinase, cAMP dependent regulatory, type I, beta; protein kinase, cAMP-dependent, regulatory subunit type I beta; protein kinase, cAMP-dependent, regulatory, type I, beta; RGD1563094; RIbeta
Common Name PRKAR1B
Gene Symbol PRKAR1B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQKSNSQSDSHDEEVSPT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.