Invitrogen™ Human PRKAR1B (aa 28-85) Control Fragment Recombinant Protein

Product Code. 30211268

Brand: Invitrogen™ RP92833

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55392 (PA5-55392. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The second messenger cyclic AMP (cAMP) mediates diverse cellular responses to external signals such as proliferation, ion transport, regulation of metabolism and gene transcription by activation of the cAMP-dependent protein kinase (cAPK or PKA). Activation of PKA occurs when cAMP binds to the two regulatory subunits of the tetrameric PKA holoenzyme resulting in release of active catalytic subunits. Three catalytic (C) subunits have been identified that each represent specific gene products. Activation of transcription upon elevation of cAMP levels results from translocation of PKA to the nucleus where it phosphorylates the transcrip- tion factor cAMP response element binding protein (CREB) on serine 133 which in turn leads to TFIIB binding to TATA-box-binding protein TBP1, thus linking phospho-CREB to the pol II transcription initiation complex.

Specifications

• Accession Number: P31321
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5575
• Name: Human PRKAR1B (aa 28-85) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI385716; cAMP dependent protein kinase, subunit type 1 beta; cAMP dependent regulatory type I beta subunit transcript 2; cAMP dependent regulatory type I beta subunit transcript 3; cAMP dependent regulatory type I beta subunit transcript 4; cAMP-dependent protein kinase type I-beta regulatory subunit; PRKAR1; PRKAR1B; protein kinase cAMP-dependent type I regulatory subunit beta; protein kinase, cAMP dependent regulatory, type I beta; protein kinase, cAMP dependent regulatory, type I, beta; protein kinase, cAMP-dependent, regulatory subunit type I beta; protein kinase, cAMP-dependent, regulatory, type I, beta; RGD1563094; RIbeta
• Common Name: PRKAR1B
• Gene Symbol: PRKAR1B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQKSNSQSDSHDEEVSPT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining