Invitrogen™ Human PRICKLE4 (aa 53-138) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30204922	100 μL	100µL

Product Code. 30204922 Supplier Invitrogen™ Supplier No. RP108922

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139969 (PA5-139969. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C6ORF49 is a member of the LIM domain protein family.

Specifications

• Accession Number: Q2TBC4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29964
• Name: Human PRICKLE4 (aa 53-138) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C6orf49; OBTP; OEBT; overexpressed breast tumor protein; over-expressed breast tumor protein; overexpressed breast tumour protein; pric4; prickle homolog 4; prickle planar cell polarity protein 4; PRICKLE4; prickle-like protein 4; TOMM6; translocase of outer mitochondrial membrane 6 homolog
• Common Name: PRICKLE4
• Gene Symbol: PRICKLE4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AELQLFCARRKQEALGQGVARLVLPKLEGHTCEKCRELLKPGEYGVFAARAGEQRCWHQPCFACQACGQALINLIYFYHDGQLYCG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining