missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30205796

Invitrogen™ Human PREX2 (aa 576-674) Control Fragment Recombinant Protein

Product Code. 30205796
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205796

Brand: Invitrogen™ RP108064

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67400 (PA5-67400. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Functions as a RAC1 guanine nucleotide exchange factor (GEF), activating Rac proteins by exchanging bound GDP for free GTP. Its activity is synergistically activated by phosphatidylinositol 3,4,5-trisphosphate and the beta gamma subunits of heterotrimeric G protein. Mediates the activation of RAC1 in a PI3K-dependent manner. May be an important mediator of Rac signaling, acting directly downstream of both G protein-coupled receptors and phosphoinositide 3-kinase.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q70Z35
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80243
Name Human PREX2 (aa 576-674) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6230420N16Rik; AI316880; AI553603; C030045D06Rik; D430013K02; DEP domain containing 2; DEP domain-containing protein 2; DEP0.2; Depdc2; phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein; phosphatidylinositol-3,4,5-trisphosphate dependent Rac exchange factor 2; phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2; PPP1R129; Pre x 2; P-Re x 2; protein phosphatase 1, regulatory subunit 129; ptdIns(3,4,5)-dependent Rac exchanger 2; si:ch211-278g15.1
Common Name PREX2
Gene Symbol PREX2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HRLMKHDLKVVENVIAKSLLIKSNEGSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFMRPFNEVDCFLKSCLNSRKPLRVLVSTKP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.