missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PREP (aa 341-435) Control Fragment Recombinant Protein

Product Code. 30193922
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30193922

Brand: Invitrogen™ RP94646

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56723 (PA5-56723. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

p33cdk2 associates with cyclin A in human cells. Kinase activity associated with cyclin A-cdc2 is found only in G2-phase. Cdk2 also complexes with cyclins E, D1, and D3. Cyclin E-cdk2 kinase is active in the G1- and S-phases of the cell cycle and is important (as does cyclin A-cdk2) for the progression from G1-to S-phase. The levels of cyclin A-cdk2 is maximal at the G1/S transition and both cdk2 and cyclin A are found associated with DNA in the initiation complex during replication. Rb protein acts as substrate for cdk2-cyclin E and/or cdk2-cyclin A in vivo. Cdk2 is activated and specifically localized to the nucleus during late G1-, S-, and G2-phase.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P48147
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5550
Name Human PREP (aa 341-435) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI047692; AI450383; D10Wsu136e; dJ355L5.1 (prolyl endopeptidase); EC 3.4.21.26; MGC16060; PE; PE {ECO:0000250; PEP; Pop; post-proline cleaving enzyme; post-proline cleaving enzyme {ECO:0000250; Prep; prep {ECO:0000312; Prolyl endopeptidase; prolyl endopeptidase {ECO:0000250; prolyl oligopeptidase; RGD:620841}; rPop; UniProtKB:P23687}
Common Name PREP
Gene Symbol PREP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IACVRSNFLVLCYLHDVKNILQLHDLTTGALLKTFPLDVGSIVGYSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.