Invitrogen™ Human PRELID1 (aa 74-200) Control Fragment Recombinant Protein

Product Code. 30213142

Brand: Invitrogen™ RP102152

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52187 (PA5-52187. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be important for the development of vital and immunocompetent organs.

Specifications

• Accession Number: Q9Y255
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 27166
• Name: Human PRELID1 (aa 74-200) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 25 kDa protein of relevant evolutionary and lymphoid interest; 2610524G07Rik; CGI-106; Preli; PRELI domain containing 1; PRELI domain-containing protein 1, mitochondrial; PRELID1; protein of relevant evolutionary and lymphoid interest; P x 19; P x 19 homolog; p x 19-like protein; RGD1308082; SBBI12
• Common Name: PRELID1
• Gene Symbol: PRELID1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VAHSVYVLEDSIVDPQNQTMTTFTWNINHARLMVVEERCVYCVNSDNSGWTEIRREAWVSSSLFGVSRAVQEFGLARFKSNVTKTMKGFEYILAKLQGEAPSKTLVETAKEAKEKAKETALAATEKA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining