Invitrogen™ Human PRDM7 (aa 364-426) Control Fragment Recombinant Protein

Product Code. 30201789

Brand: Invitrogen™ RP101255

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (29%), Rat (29%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63800 (PA5-63800. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of a family of proteins that may have roles in transcription and other nuclear processes. The encoded protein contains a KRAB (Kruppel-associated box) domain -A box and a SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) domain and may function as a histone methyltransferase.

Specifications

• Accession Number: Q9NQW5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11105
• Name: Human PRDM7 (aa 364-426) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: histone-lysine N-methyltransferase PRDM9-like; PFM4; PR domain 7; PR domain containing 7; PR domain containing 9; PR domain zinc finger protein 7; PR domain-containing protein 7; PR/SET domain 7; PRDM7; Prdm9; PR-domain family protein 4; probable histone-lysine N-methyltransferase PRDM7; ZNF910
• Common Name: PRDM7
• Gene Symbol: PRDM7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELGIRSSIEPAESLGQAVNCWSGMGMSMARNWASSGAASGRKSSWQGENQSQRSIHVPHAVWP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining