Invitrogen™ Human PRDM5 (aa 258-328) Control Fragment Recombinant Protein

Product Code. 30201915

Brand: Invitrogen™ RP101330

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84064 (PA5-84064. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PRDM5, a novel member of PR domain protein family, contains a PR-domain at the -NH2 terminus followed by 16 zinc finger motifs. It is found to have a role in cell differentiation and tumorigenesis. Reports suggest PRDM5 causes G2/M arrest and apoptosis upon infection of tumor cells and has been found to be silenced in breast, ovarian and lung cancers, suggesting a potential clinical significance.

Specifikationer

• Accession Number: Q9NQX1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11107
• Name: Human PRDM5 (aa 258-328) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4432417F03Rik; 6530401I24Rik; AI197291; BCS2; E130112L17Rik; PFM2; PR domain 5; PR domain containing 5; PR domain zinc finger protein 5; PR domain-containing protein 5; PR/SET domain 5; PRDM5; unm hi61; un-named hi61
• Common Name: PRDM5
• Gene Symbol: PRDM5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GDARFVCKADSCGKRLKSKDALKRHQENVHTGDPKKKLICSVCNKKCSSASSLQEHRKIHEIFDCQECMKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining