Invitrogen™ Human PRDM2 (aa 1300-1433) Control Fragment Recombinant Protein

Product Code. 30209013

Brand: Invitrogen™ RP89330

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82218 (PA5-82218. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PRDM2, a member of nuclear/histone methyltransferase superfamily, consists of an N-terminal PR domain, an Rb-binding motif, 8 Kruppel-like zinc finger motifs, Nuclear hormone-receptor binding motif and a C-terminal PR-domain binding motif. Ubiquitously expressed in low levels, PRDM2 exists in 2 isoforms, a 280 kDa RIZ1 containing PR-domain and a 250 kDa truncated RIZ2 that lacks PR-domain. A tumor suppressor with a prominent role in cell growth and differentiation, PRDM2 binds to Retinoblastoma protein, estrogen receptor, GATA-3 and TPA-responsive element (MTE) of Heme-oxygenase-1 gene and influences pathogenesis of Retinoblastoma, transcriptional regulation during neuronal differentiation, transactivation of Heme-oxygenase-1 gene and specific effector of estrogen action. It is inactivated or altered due to mutations and hypermethylation in many types of human cancers suggesting a potential biomarker.

Specifications

• Accession Number: Q13029
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7799
• Name: Human PRDM2 (aa 1300-1433) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4833427P12Rik; E330024L24Rik; G3b; GATA-3 binding protein G3B; GATA-3-binding protein G3B; Gm1033; Gm19732; HUMHOXY1; KMT8; lysine N-methyltransferase 8; MTBzf; MTB-ZF; MTE-binding protein; PR domain 2; PR domain containing 2, with ZNF domain; PR domain zinc finger protein 2; PR domain-containing protein 2; Prdm2; retinoblastoma interacting zinc finger protein; retinoblastoma protein-binding zinc finger protein; retinoblastoma protein-interacting zinc finger protein; RIZ; RIZ1; RIZ2; RP5-1177E19.1; zinc finger protein RIZ; zinc-finger DNA-binding protein; Znfpr1c1
• Common Name: PRDM2
• Gene Symbol: PRDM2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PPPFQYHHRNPMGIGVTATNFTTHNIPQTFTTAIRCTKCGKGVDNMPELHKHILACASASDKKRYTPKKNPVPLKQTVQPKNGVVVLDNSGKNAFRRMGQPKRLNFSVELSKMSSNKLKLNALKKKNQLVQKAI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining