missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PRDM2 (aa 1300-1433) Control Fragment Recombinant Protein

Product Code. 30209013
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209013

Brand: Invitrogen™ RP89330

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82218 (PA5-82218. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PRDM2, a member of nuclear/histone methyltransferase superfamily, consists of an N-terminal PR domain, an Rb-binding motif, 8 Kruppel-like zinc finger motifs, Nuclear hormone-receptor binding motif and a C-terminal PR-domain binding motif. Ubiquitously expressed in low levels, PRDM2 exists in 2 isoforms, a 280 kDa RIZ1 containing PR-domain and a 250 kDa truncated RIZ2 that lacks PR-domain. A tumor suppressor with a prominent role in cell growth and differentiation, PRDM2 binds to Retinoblastoma protein, estrogen receptor, GATA-3 and TPA-responsive element (MTE) of Heme-oxygenase-1 gene and influences pathogenesis of Retinoblastoma, transcriptional regulation during neuronal differentiation, transactivation of Heme-oxygenase-1 gene and specific effector of estrogen action. It is inactivated or altered due to mutations and hypermethylation in many types of human cancers suggesting a potential biomarker.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13029
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7799
Name Human PRDM2 (aa 1300-1433) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4833427P12Rik; E330024L24Rik; G3b; GATA-3 binding protein G3B; GATA-3-binding protein G3B; Gm1033; Gm19732; HUMHOXY1; KMT8; lysine N-methyltransferase 8; MTBzf; MTB-ZF; MTE-binding protein; PR domain 2; PR domain containing 2, with ZNF domain; PR domain zinc finger protein 2; PR domain-containing protein 2; Prdm2; retinoblastoma interacting zinc finger protein; retinoblastoma protein-binding zinc finger protein; retinoblastoma protein-interacting zinc finger protein; RIZ; RIZ1; RIZ2; RP5-1177E19.1; zinc finger protein RIZ; zinc-finger DNA-binding protein; Znfpr1c1
Common Name PRDM2
Gene Symbol PRDM2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PPPFQYHHRNPMGIGVTATNFTTHNIPQTFTTAIRCTKCGKGVDNMPELHKHILACASASDKKRYTPKKNPVPLKQTVQPKNGVVVLDNSGKNAFRRMGQPKRLNFSVELSKMSSNKLKLNALKKKNQLVQKAI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.