Invitrogen™ Human PRAS40 (aa 100-180) Control Fragment Recombinant Protein

Product Code. 30194807

Brand: Invitrogen™ RP110008

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Akt signaling pathway contributes to the regulation of apoptosis after a variety of cell death signals. AKT1S1, also known as PRAS40, is a proline-rich substrate of the kinase AKT1 and is thought to play a role in neuroprotection mediated by nerve growth factor (NGF) after transient focal cerebral ischemia. AKT1S1 is also a substrate and potential regulator of mammalian target of rapamycin (mTOR), a serine/threonine kinase that regulates cell growth and cell cycle, and a negative regulator of autophagy. Treatment with the insulin-like growth factor-1 (IGF1) can induce the phosphorylation of AKT1S1 via the PI3K/AKT signaling pathway in PC12 cells.

Specifications

• Accession Number: Q96B36
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84335
• Name: Human PRAS40 (aa 100-180) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110012J22Rik; 40 kDa proline-rich AKT substrate; AI227026; AKT1 substrate 1; AKT1 substrate 1 (proline rich); AKT1 substrate 1 (proline-rich); akt1s1; Lobe; Lobel; OTTHUMP00000196756; OTTHUMP00000196760; PKB/Akt substrate 40; Pras; PRAS40; Proline-rich AKT substrate; proline-rich AKT1 substrate 1
• Common Name: PRAS40
• Gene Symbol: AKT1S1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: REDNEEDEDEPTETETSGEQLGISDNGGLFVMDEDATLQDLPPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining