Invitrogen™ Human PRAP1 Control Fragment Recombinant Protein

Product Code. 30198491

Brand: Invitrogen™ RP97157

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (43%), Rat (43%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58508 (PA5-58508. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Proline rich acidic protein 1 (PRAP1) is also named as PRO1195 or UPA. It may play an important role in maintaining normal growth homeostasis in epithelial cells. Mitotic arrest deficient 1 (MAD1) is a key component in mitotic checkpoint signaling. Recent study identified PRAP1 as a novel MAD1 binding partner using yeast-two hybrid screening. PRAP1 has four isoforms with MW 16-20 kDa and 10 kDa.

Specifications

• Accession Number: Q96NZ9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 118471
• Name: Human PRAP1 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: epididymis tissue protein Li 178; PRAP1; Pregnancy-specific uterine protein; PRO1195; proline rich acidic protein 1; proline-rich acidic protein 1; UNQ608/PRO1195; Upa; uterine-specific proline-rich acidic protein
• Common Name: PRAP1
• Gene Symbol: PRAP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PILPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining