Invitrogen™ Human PQBP1 (aa 4-150) Control Fragment Recombinant Protein

Product Code. 30206120

Brand: Invitrogen™ RP92128

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51651 (PA5-51651. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PQBP1 is a nuclear polyglutamine-binding protein that contains a WW domain. Mutations in this gene are associated with X-linked mental retardation.

Specifications

• Accession Number: O60828
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10084
• Name: Human PQBP1 (aa 4-150) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 38 kDa nuclear protein containing a WW domain; JM26; MGC129091 protein; MR x 2; MR x 55; MRXS3; MRXS8; NPW38; polyglutamine binding protein 1; polyglutamine tract-binding protein 1; Polyglutamine-binding protein 1; PQBP1; PQBP-1; RENS1; scurfy candidate 2; Sfc2; SHS
• Common Name: PQBP1
• Gene Symbol: Pqbp1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining