Invitrogen™ Human PPP3CC (aa 453-512) Control Fragment Recombinant Protein

Product Code. 30205455

Brand: Invitrogen™ RP93771

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82830 (PA5-82830. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation and a unique form of calcineurin appears to be associated with the flagellum. The calcineurin holoenzyme is composed of catalytic and regulatory subunits of 60 and 18 kD, respectively. At least 3 genes, calcineurin A-alpha, calcineurin A-beta, and calcineurin A-gamma (CALNA3), have been cloned for the catalytic subunit. These genes have been identified in humans, mice, and rats, and are highly conserved between species (90 to 95% amino acid identity).

Specifications

• Accession Number: P48454
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5533
• Name: Human PPP3CC (aa 453-512) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Calcineurin A gamma; Calcineurin, testis-specific catalytic subunit; calmodulin-dependent calcineurin A subunit gamma isoform; CALNA3; Calnc; CAM-PRP catalytic subunit; CNA3; PP2BA gamma; PP2Bgamma; PPP3CC; protein phosphatase 2 B, catalytic subunit, gamma isoform; protein phosphatase 3 (formerly 2 B), catalytic subunit, gamma isoform; protein phosphatase 3 (formerly 2 B), catalytic subunit, gamma isoform (calcineurin A gamma); protein phosphatase 3 catalytic subunit gamma; protein phosphatase 3, catalytic subunit, gamma isoform; protein phosphatase 3, catalytic subunit, gamma isozyme; serine/threonine-protein phosphatase 2 B catalytic subunit gamma isoform
• Common Name: PPP3CC
• Gene Symbol: PPP3CC
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RGFSLQHKIRSFEEARGLDRINERMPPRKDSIHAGGPMKSVTSAHSHAAHRSDQGKKAHS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining