missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194997

Invitrogen™ Human PPP2R5C (aa 375-474) Control Fragment Recombinant Protein

Product Code. 30194997
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194997

Brand: Invitrogen™ RP88937

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82984 (PA5-82984. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Phosphatases are involved in the regulation of MAP kinases.Protein phosphatase 2A (PP2A) is a critical component of the pathway responsible for p38 MAPK up-regulation of SERT catalytic activity.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13362
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5527
Name Human PPP2R5C (aa 375-474) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610043M05Rik; 2700063L20Rik; AI060890; AW545884; B' alpha regulatory subunit; B55-GAMMA; B56/PP2A gamma; B56G; Band 8 A; C85228; D12Bwg0916e; gamma isoform of regulatory subunit B56, protein phosphatase 2 A; IMYPNO; IMYPNO1; KIAA0044; MGC23064; MGC33570; mKIAA0044; PP2A B subunit isoform B56-gamma; PP2A B subunit isoform B'-alpha-3; PP2A B subunit isoform B'-gamma; PP2A B subunit isoform PR61-gamma; PP2A B subunit isoform R5-gamma; Ppp2r5c; PR52; PR55G; PR61G; protein phosphatase 2 regulatory subunit B', gamma; protein phosphatase 2 regulatory subunit B'gamma; protein phosphatase 2, regulatory subunit B (B56), gamma isoform; protein phosphatase 2, regulatory subunit B', gamma; protein phosphatase 2, regulatory subunit B', gamma isoform; renal carcinoma antigen NY-REN-29; Serine/threonine-protein phosphatase 2 A 56 kDa regulatory subunit gamma isoform
Common Name PPP2R5C
Gene Symbol PPP2R5C
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIENLAKANPQAQKDPKKDRPLARRKSELPQDPHTKKALEAHC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.