missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PPP2R5B (aa 433-488) Control Fragment Recombinant Protein

Product Code. 30201108
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201108

Brand: Invitrogen™ RP97258

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57740 (PA5-57740. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes a beta isoform of the catalytic subunit. Two transcript variants encoding the same protein have been identified for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q15173
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5526
Name Human PPP2R5B (aa 433-488) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias B56B; B'beta; BC026670; FLJ35411; LOC100909468; PP2A; PP2A B subunit isoform B56-beta; PP2A B subunit isoform B'-beta; PP2A B subunit isoform PR61-beta; PP2A B subunit isoform R5-beta; Ppp2r5b; PR61B; protein phosphatase 2 regulatory subunit B', beta; protein phosphatase 2 regulatory subunit B'beta; protein phosphatase 2, regulatory subunit B (B56), beta isoform; protein phosphatase 2, regulatory subunit B', beta; protein phosphatase 2, regulatory subunit B', beta isoform; protein phosphotase 2, regulatory subunit B (B56), beta isoform; rCG_47223; serine/threonine protein phosphatase 2 A, 56 kDa regulatory subunit, beta isoform; serine/threonine-protein phosphatase 2 A 56 kDa regulatory subunit beta isoform
Common Name PPP2R5B
Gene Symbol PPP2R5B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKEAPLQRLTP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.