Invitrogen™ Human PPP2R5B (aa 433-488) Control Fragment Recombinant Protein

Product Code. 30201108

Brand: Invitrogen™ RP97258

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57740 (PA5-57740. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes a beta isoform of the catalytic subunit. Two transcript variants encoding the same protein have been identified for this gene.

Specifications

• Accession Number: Q15173
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5526
• Name: Human PPP2R5B (aa 433-488) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: B56B; B'beta; BC026670; FLJ35411; LOC100909468; PP2A; PP2A B subunit isoform B56-beta; PP2A B subunit isoform B'-beta; PP2A B subunit isoform PR61-beta; PP2A B subunit isoform R5-beta; Ppp2r5b; PR61B; protein phosphatase 2 regulatory subunit B', beta; protein phosphatase 2 regulatory subunit B'beta; protein phosphatase 2, regulatory subunit B (B56), beta isoform; protein phosphatase 2, regulatory subunit B', beta; protein phosphatase 2, regulatory subunit B', beta isoform; protein phosphotase 2, regulatory subunit B (B56), beta isoform; rCG_47223; serine/threonine protein phosphatase 2 A, 56 kDa regulatory subunit, beta isoform; serine/threonine-protein phosphatase 2 A 56 kDa regulatory subunit beta isoform
• Common Name: PPP2R5B
• Gene Symbol: PPP2R5B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKEAPLQRLTP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining